missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIGQ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59738
This item is not returnable.
View return policy
Description
PIGQ Polyclonal specifically detects PIGQ in Human samples. It is validated for Western Blot.
Specifications
| PIGQ | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| c407A10.1, c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)), class Q, EC 2.4.1.198, hGPI1, MGC12693, N-acetylglucosaminyl transferase component Gpi1, N-acetylglucosamyl transferase component GPI1, phosphatidylinositol glycan anchor biosynthesis, class Q, phosphatidylinositol N-acetylglucosaminyltransferase subunit Q, Phosphatidylinositol-glycan biosynthesis class Q protein, PIG-Q | |
| Rabbit | |
| 84 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9BRB3 | |
| PIGQ | |
| Synthetic peptides corresponding to PIGQ(phosphatidylinositol glycan anchor biosynthesis, class Q) The peptide sequence was selected from the N terminal of PIGQ. Peptide sequence VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL. | |
| Affinity purified | |
| RUO | |
| 9091 | |
| Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction