missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16156736

Abnova™ PIGP (Human) Recombinant Protein (P01)

Product Code. 16156736
Click to view available options
:
2 ug
This item is not returnable. View return policy

Product Code. 16156736

Brand: Abnova™ H00051227P01.2ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Human Recombinant Protein

Human PIGP full-length ORF ( AAH05180, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specifications

Accession Number AAH05180
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
Gene ID (Entrez) 51227
Name phosphatidylinositol glycan anchor biosynthesis, class P
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 2 μg
Source Wheat Germ (in vitro)
Storage Requirements Store at -80°C Aliquot to avoid repeated freezing and thawing
Gene Alias DCRC,DCRC-S,DSCR5,DSRC
Common Name PIGP
Recombinant Recombinant
Sequence MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
Target Species Named Human
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.