missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PIGM Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£150.00 - £366.00
Specifications
| Antigen | PIGM |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18683592
|
Novus Biologicals
NBP2-94070-0.02ml |
0.02 mL |
£150.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661882
|
Novus Biologicals
NBP2-94070-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PIGM Polyclonal antibody specifically detects PIGM in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| PIGM | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 93183 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 2.4.1, EC 2.4.1.-, GPI mannosyltransferase 1, GPI mannosyltransferase I, GPI-MT-IPIG-M mannosyltransferase, MGC29896, phosphatidylinositol glycan anchor biosynthesis, class M, phosphatidylinositol glycan, class M, Phosphatidylinositol-glycan biosynthesis class M protein, PIG-M | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 35-96 of human PIGM (NP_660150.1). YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title