missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pierce-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68830
This item is not returnable.
View return policy
Description
Pierce-1 Polyclonal antibody specifically detects Pierce-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Pierce-1 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| C9orf116, chromosome 9 open reading frame 116, FLJ13945, hypothetical protein LOC138162, MGC29761, Pierce 1, RbEST47, RP11-426A6.4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN | |
| 100 μg | |
| Apoptosis | |
| 138162 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction