missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PI 3-Kinase p85 beta Rabbit anti-Human, Mouse, Rat, Clone: 6E2F5, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-16493-100UL
This item is not returnable.
View return policy
Description
PI 3-Kinase p85 beta Monoclonal antibody specifically detects PI 3-Kinase p85 beta in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| PI 3-Kinase p85 beta | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 6E2F5 | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| P85B, phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta, phosphatidylinositol 3-kinase regulatory subunit beta, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit 2 (beta), phosphoinositide-3-kinase, regulatory subunit 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta), PI3K regulatory subunit beta, PI3-kinase regulatory subunit beta, PI3-kinase subunit p85-beta, ptdIns-3-kinase regulatory subunit beta, ptdIns-3-kinase regulatory subunit p85-beta | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI 3-Kinase p85 beta (O00459). PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE | |
| 100 μg | |
| Autophagy, Signal Transduction | |
| 5296 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction