missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PI 3-Kinase p110 delta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | PI 3-Kinase p110 delta |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18729523
|
Novus Biologicals
NBP2-38535 |
0.1 mL |
£488.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18665375
|
Novus Biologicals
NBP2-38535-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PI 3-Kinase p110 delta Polyclonal specifically detects PI 3-Kinase p110 delta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PI 3-Kinase p110 delta | |
| Polyclonal | |
| Rabbit | |
| Autophagy, mTOR Pathway, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5293 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.1, EC 2.7.1.153, p110D, P110DELTA, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform, phosphoinositide-3-kinase C, phosphoinositide-3-kinase, catalytic, delta polypeptide, PI3K, PI3K-delta, PI3-kinase p110 subunit delta, PI3-kinase subunit delta, PtdIns-3-kinase subunit delta, PtdIns-3-kinase subunit p110-delta | |
| PIK3CD | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title