missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PI 3-Kinase C2 beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | PI 3-Kinase C2 beta |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18208072
|
Novus Biologicals
NBP2-58352 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633588
|
Novus Biologicals
NBP2-58352-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PI 3-Kinase C2 beta Polyclonal specifically detects PI 3-Kinase C2 beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PI 3-Kinase C2 beta | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 5287 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| C2-PI3KDKFZp686G16234, EC 2.7.1, EC 2.7.1.154, phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta, Phosphoinositide 3-kinase-C2-beta, phosphoinositide-3-kinase, class 2, beta polypeptide, PI3K-C2beta, PI3K-C2-beta, PTDINS-3-kinase C2 beta, PtdIns-3-kinase C2 subunit beta | |
| PIK3C2B | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title