missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHYHIPL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£342.00 - £470.00
Specifications
| Antigen | PHYHIPL |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18459350
|
Novus Biologicals
NBP1-84858-25ul |
25ul |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18214657
|
Novus Biologicals
NBP1-84858 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PHYHIPL Polyclonal specifically detects PHYHIPL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PHYHIPL | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 84457 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Em:AC025038.1, KIAA1796phytanoyl-CoA hydroxylase interacting protein-like, phytanoyl-CoA 2-hydroxylase interacting protein-like, phytanoyl-CoA hydroxylase-interacting protein-like | |
| PHYHIPL | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title