missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHYHIPL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£342.00 - £470.00
Specifications
| Antigen | PHYHIPL |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18459350
|
Novus Biologicals
NBP1-84858-25ul |
25ul |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18214657
|
Novus Biologicals
NBP1-84858 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
PHYHIPL Polyclonal specifically detects PHYHIPL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| PHYHIPL | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 84457 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Em:AC025038.1, KIAA1796phytanoyl-CoA hydroxylase interacting protein-like, phytanoyl-CoA 2-hydroxylase interacting protein-like, phytanoyl-CoA hydroxylase-interacting protein-like | |
| PHYHIPL | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel