missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHYHIPL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | PHYHIPL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PHYHIPL Polyclonal specifically detects PHYHIPL in Human samples. It is validated for Western Blot.Specifications
| PHYHIPL | |
| Polyclonal | |
| Rabbit | |
| Q96FC7 | |
| 84457 | |
| Synthetic peptides corresponding to PHYHIPL (phytanoyl-CoA 2-hydroxylase interacting protein-like) The peptide sequence was selected from the C terminal of PHYHIPL. Peptide sequence QDVILEVIYTDPVDLSVGTVAEITGHQLMSLSTANAKKDPSCKTCNISVG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Em:AC025038.1, KIAA1796phytanoyl-CoA hydroxylase interacting protein-like, phytanoyl-CoA 2-hydroxylase interacting protein-like, phytanoyl-CoA hydroxylase-interacting protein-like | |
| PHYHIPL | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title