missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PHOX2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

PHOX2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18384097
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18384097 25 μg 25µL
18333133 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18384097 Supplier Novus Biologicals Supplier No. NBP31791025UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PHOX2A Polyclonal antibody specifically detects PHOX2A in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen PHOX2A
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive, aristaless homeobox homolog, Aristaless homeobox protein homolog, arix homeodomain protein, ARIX1 homeodomain protein, ARIXNCAM2, CFEOM2MGC52227, paired mesoderm homeobox protein 2A, paired-like homeobox 2apaired-like (aristaless) homeobox 2a, PMX2AFEOM2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPY
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Growth and Development, Neuronal Cell Markers, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 401
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.