missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHOX2A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17910-100UL
This item is not returnable.
View return policy
Description
PHOX2A Polyclonal antibody specifically detects PHOX2A in Human samples. It is validated for Immunofluorescence
Specifications
| PHOX2A | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive, aristaless homeobox homolog, Aristaless homeobox protein homolog, arix homeodomain protein, ARIX1 homeodomain protein, ARIXNCAM2, CFEOM2MGC52227, paired mesoderm homeobox protein 2A, paired-like homeobox 2apaired-like (aristaless) homeobox 2a, PMX2AFEOM2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPY | |
| 100 μg | |
| Growth and Development, Neuronal Cell Markers, Neuroscience | |
| 401 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction