missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Phosphoglucomutase 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Phosphoglucomutase 5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Phosphoglucomutase 5 Polyclonal specifically detects Phosphoglucomutase 5 in Human samples. It is validated for Western Blot.Specifications
| Phosphoglucomutase 5 | |
| Polyclonal | |
| Rabbit | |
| aciculin, EC 5.4.2.2, PGM-RP, PGMRPphosphoglucomutase-like protein 5, phosphoglucomutase 5, Phosphoglucomutase-related protein | |
| PGM5 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 5239 | |
| Synthetic peptides corresponding to the N terminal of PGM5. Immunizing peptide sequence IPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title