missing translation for 'onlineSavingsMsg'
Learn More

Phosphodiesterase 4D Antibody, Novus Biologicals™

Product Code. 18414101 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18414101 0.1 mL 0.1mL
18433271 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18414101 Supplier Novus Biologicals Supplier No. NBP192265

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Phosphodiesterase 4D Polyclonal antibody specifically detects Phosphodiesterase 4D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Phosphodiesterase 4D
Applications Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E3), cAMP-specific 3'-5'-cyclic phosphodiesterase 4D, cAMP-specific phosphodiesterase PDE4D6, DKFZp686M11213, Drosophila), dunce-like phosphodiesterase E3, EC 3.1.4, FLJ97311, HSPDE4D, phosphodiesterase 4D, cAMP-specific, phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5144
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.