missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGRMC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49289-25ul
This item is not returnable.
View return policy
Description
PGRMC2 Polyclonal antibody specifically detects PGRMC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| PGRMC2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| DG6progesterone membrane binding protein, membrane-associated progesterone receptor component 2, PMBPProgesterone membrane-binding protein, progesterone receptor membrane component 2, Steroid receptor protein DG6 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 10424 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction