missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGPEP-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | PGPEP-1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PGPEP-1 Polyclonal specifically detects PGPEP-1 in Human samples. It is validated for Western Blot.Specifications
| PGPEP-1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 3.4.19.3, Pcp, PGPIFLJ20208, PGP-IPAP-I, PGPMGC10812, Pyroglutamyl aminopeptidase I, pyroglutamyl-peptidase 1, pyroglutamyl-peptidase I5-oxoprolyl-peptidase, Pyrrolidone-carboxylate peptidase | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human PGPEP-1 (NP_060182). Peptide sequence KHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGP | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 54858 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title