missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGM1 Antibody (CL3301), Novus Biologicals™
Mouse Monoclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | PGM1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18285315
|
Novus Biologicals
NBP2-59026 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18668918
|
Novus Biologicals
NBP2-59026-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PGM1 Monoclonal specifically detects PGM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PGM1 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| 5236 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Unconjugated | |
| Mouse | |
| Lipid and Metabolism | |
| EC 5.4.2, EC 5.4.2.2, Glucose phosphomutase 1, GSD14, PGM 1, phosphoglucomutase 1, phosphoglucomutase-1 | |
| PGM1 | |
| IgG1 | |
| Protein A purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title