missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGLYRP2/PGRP-L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | PGLYRP2/PGRP-L |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18253975
|
Novus Biologicals
NBP2-57939 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698786
|
Novus Biologicals
NBP2-57939-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PGLYRP2/PGRP-L Polyclonal specifically detects PGLYRP2/PGRP-L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PGLYRP2/PGRP-L | |
| Polyclonal | |
| Rabbit | |
| Immunology, Inflammation | |
| EC 3.5.1.28, peptidoglycan recognition protein 2tagl-beta, peptidoglycan recognition protein L, PGLYRPLHMFT0141, PGRP-LN-acetylmuramoyl-L-alanine amidase, PGRPLPeptidoglycan recognition protein long, tagL, tagL-alpha, TAGL-like | |
| PGLYRP2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 114770 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKRSRREPPPRTLPATDL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title