missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGCP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PGCP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PGCP Polyclonal specifically detects PGCP in Human samples. It is validated for Western Blot.Specifications
| PGCP | |
| Polyclonal | |
| Rabbit | |
| Q9Y646 | |
| 10404 | |
| Synthetic peptides corresponding to PGCP(plasma glutamate carboxypeptidase) The peptide sequence was selected from the N terminal of PGCP. Peptide sequence VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| aminopeptidase, EC 3.4.17, EC 3.4.17.-, plasma glutamate carboxypeptidase | |
| CPQ | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title