missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGC-1 beta Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94238-0.02ml
This item is not returnable.
View return policy
Description
PGC-1 beta Polyclonal antibody specifically detects PGC-1 beta in Human, Mouse samples. It is validated for Western Blot
Specifications
| PGC-1 beta | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DKFZp686C1790, ERRL1, PERCFLJ14284, peroxisome proliferator-activated receptor gamma, coactivator 1 beta, PGC1, PGC1Bgamma, coactivator 1, beta, PPARGC1 | |
| A synthetic peptide corresponding to a sequence within amino acids 850-950 of human PGC1 beta (NP_001166170.1). SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSL | |
| 0.02 mL | |
| Breast Cancer, Cancer, Chromatin Research, Diabetes Research, Hypoxia, Lipid and Metabolism, Mitochondrial Markers, Neuroscience, Signal Transduction | |
| 133522 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction