missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGBD3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PGBD3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PGBD3 Polyclonal specifically detects PGBD3 in Human samples. It is validated for Western Blot.Specifications
| PGBD3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ90201, piggyBac transposable element derived 3, piggyBac transposable element-derived protein 3 | |
| PGBD3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N328 | |
| 267004 | |
| Synthetic peptides corresponding to PGBD3(piggyBac transposable element derived 3) The peptide sequence was selected from the N terminal of PGBD3. Peptide sequence AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title