PGAP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69334

Product Code. 18203404

Description

PGAP3 Polyclonal specifically detects PGAP3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PGAP3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AGLA546, CAB2COS16 homolog, Gene coamplified with ERBB2 protein, MGC9753hCOS16, PER1, per1-like domain containing 1, PERLD1PER1-like domain-containing protein 1, post-GPI attachment to proteins 3, post-GPI attachment to proteins factor 3, PP1498
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Rat: 86%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96FM1
• Gene Symbols: PGAP3
• Immunogen: Synthetic peptides corresponding to PERLD1(per1-like domain containing 1) The peptide sequence was selected from the N terminal of PERLD1. Peptide sequence AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 93210
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only