missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PGAP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86692
This item is not returnable.
View return policy
Description
PGAP3 Polyclonal specifically detects PGAP3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| PGAP3 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20 | |
| AGLA546, CAB2COS16 homolog, Gene coamplified with ERBB2 protein, MGC9753hCOS16, PER1, per1-like domain containing 1, PERLD1PER1-like domain-containing protein 1, post-GPI attachment to proteins 3, post-GPI attachment to proteins factor 3, PP1498 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 93210 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PGAP3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction