PGA5, Mouse anti-Human, Clone: 4G9, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00005222-M02/DEL

Product Code. 16132685

Description

Sequence: WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGD

Specifications

• Antigen: PGA5
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: pepsinogen 5, group I (pepsinogen A)
• Gene Alias: -
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4G9
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_014224
• Gene Symbols: PGA5
• Immunogen: PGA5 (NP_055039, 203 a.a. ∼ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 5222
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ