missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEX5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PEX5 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
PEX5 Polyclonal specifically detects PEX5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PEX5 | |
| Unconjugated | |
| RUO | |
| FLJ50634, FLJ50721, Peroxin-5, peroxisomal biogenesis factor 5, Peroxisomal C-terminal targeting signal import receptor, peroxisomal targeting signal 1 receptor, peroxisomal targeting signal import receptor, peroxisomal targeting signal receptor 1, Peroxisome receptor 1peroxin-5, PTS1 receptor, PTS1-BP, PTS1RFLJ51948, PXR1peroxisomal targeting signal 1 (SKL type) receptor | |
| PEX5 | |
| IgG | |
| 70 kDa |
| Polyclonal | |
| Rabbit | |
| P50542-3 | |
| 5830 | |
| Synthetic peptides corresponding to PEX5(peroxisomal biogenesis factor 5) The peptide sequence was selected from the middle region of PEX5. Peptide sequence LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title