missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEX26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PEX26 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PEX26 Polyclonal specifically detects PEX26 in Human samples. It is validated for Western Blot.Specifications
| PEX26 | |
| Polyclonal | |
| Rabbit | |
| Q7Z412 | |
| 55670 | |
| Synthetic peptides corresponding to PEX26(peroxisomal biogenesis factor 26) The peptide sequence was selected from the middle region of PEX26. Peptide sequence ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ20695, peroxin-26, peroxisomal biogenesis factor 26, peroxisome assembly protein 26, peroxisome biogenesis disorder, complementation group 8, peroxisome biogenesis disorder, complementation group A, peroxisome biogenesis factor 26, PEX26M1T, Pex26pM1T | |
| PEX26 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title