PEX14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18457321	Novus Biologicals NBP2-33455-25ul	25 μL
18028615	Novus Biologicals NBP2-33455	0.1 mL

Description

PEX14 Polyclonal specifically detects PEX14 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PEX14
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: dJ734G22.2, MGC12767, NAPP2, NF-E2 associated polypeptide 2, peroxin-14, peroxisomal biogenesis factor 14, Peroxisomal membrane anchor protein PEX14, peroxisomal membrane anchor protein Pex14p, peroxisomal membrane protein PEX14, Pex14p, PTS1 receptor docking protein, PTS1 receptor-docking protein
• Gene Symbols: PEX14
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: O75381
• Gene ID (Entrez): 5195
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IQQQQKIQELAHELAAAKATTSTNWILESQNINELKSEINSLKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only