Peroxiredoxin 6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55159

Product Code. 18264511

Description

Peroxiredoxin 6 Polyclonal specifically detects Peroxiredoxin 6 in Human, Rat, Porcine samples. It is validated for Western Blot.

Specifications

• Antigen: Peroxiredoxin 6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 1-Cys, 24 kDa protein, Acidic calcium-independent phospholipase A2, aiPLA21-Cys PRX, Antioxidant protein 2, AOP2Non-selenium glutathione peroxidase, EC 1.11.1.15, EC 1.11.1.7, EC 3.1.1.-, KIAA0106Red blood cells page spot 12, Liver 2D page spot 40, MGC46173, NSGPx1-Cys peroxiredoxin, p29, peroxiredoxin 6, peroxiredoxin-6, PRX
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P30041
• Gene Symbols: PRDX6
• Immunogen: Synthetic peptides corresponding to PRDX6(peroxiredoxin 6) The peptide sequence was selected from the middle region of PRDX6 (NP_004896). Peptide sequence ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9588
• Target Species: Human, Rat, Pig, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Form: Purified

For Research Use Only