missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Peroxiredoxin 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58348
This item is not returnable.
View return policy
Description
Peroxiredoxin 5 Polyclonal specifically detects Peroxiredoxin 5 in Human samples. It is validated for Western Blot.
Specifications
| Peroxiredoxin 5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ACR1Peroxisomal antioxidant enzyme, Alu corepressor 1, Alu co-repressor 1, Antioxidant enzyme B166, AOEB166Peroxiredoxin V, B166, EC 1.11.1.15, Liver tissue 2D-page spot 71B, MGC117264, MGC142283, MGC142285, peroxiredoxin 5, peroxiredoxin-5, mitochondrial, PLPThioredoxin peroxidase PMP20, PMP20, PRDX6, prx-V, PRXV, SBBI10, Thioredoxin reductase, TPx type VI | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 25824 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| B7ZVW3 | |
| PRDX5 | |
| Synthetic peptides corresponding to PRDX5(peroxiredoxin 5) The peptide sequence was selected from the middle region of PRDX5. Peptide sequence TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Equine: 92%; Mouse: 92%; Pig: 92%; Rat: 92%; Goat: 78%. | |
| Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Goat, Sheep | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction