Peroxiredoxin 4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17000-100UL

Product Code. 18349105

Description

Peroxiredoxin 4 Polyclonal antibody specifically detects Peroxiredoxin 4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Peroxiredoxin 4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Antioxidant enzyme AOE372, AOE37-2PRX-4, EC 1.11.1.15, peroxiredoxin 4, Peroxiredoxin IV, peroxiredoxin-4, prx4, prx-4, Prx-IV, thioredoxin peroxidase (antioxidant enzyme), Thioredoxin peroxidase AO372, Thioredoxin-dependent peroxide reductase A0372
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10549
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified