missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Perilipin-3/TIP47 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49485
This item is not returnable.
View return policy
Description
Perilipin-3/TIP47 Polyclonal antibody specifically detects Perilipin-3/TIP47 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Specifications
| Perilipin-3/TIP47 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
| Cargo selection protein TIP47, M6PRBP1MGC2012, Mannose-6-phosphate receptor-binding protein 1, perilipin 3,47 kDa MPR-binding protein, perilipin-3, Placental protein 17,47 kDa mannose 6-phosphate receptor-binding protein, PP17MGC11117, tail-interacting protein, 47 kD, TIP47mannose-6-phosphate receptor binding protein 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ | |
| 0.1 mL | |
| Diabetes Research, Golgi Apparatus Markers, Lipid and Metabolism, Lipid Droplets, Signal Transduction | |
| 10226 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction