missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PER3 Polyclonal specifically detects PER3 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | PER3 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila) |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PER3 (NP_058515). Peptide sequence GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?