PER3 Rabbit anti-Human, Mouse, Rat, Clone: 9I3I6, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-16094-20UL

Product Code. 18322745

Description

PER3 Monoclonal antibody specifically detects PER3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: PER3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Clone: 9I3I6
• Dilution: Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila)
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human PER3 (P56645). GRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQIL
• Quantity: 20 μg
• Research Discipline: Cardiovascular Biology, Endocrinology
• Gene ID (Entrez): 8863
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG