missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PER2 Monoclonal antibody specifically detects PER2 in Human, Mouse samples. It is validated for Western Blot, ChIP assay, Immunofluorescence
Specifications
Specifications
| Antigen | PER2 |
| Applications | ChIP Assay, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 2K9Y0 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Chromatin Immunoprecipitation 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Circadian clock protein PERIOD 2, FASPS, hPER2, KIAA0347period 2, period (Drosophila) homolog 2, period circadian protein 2, period circadian protein homolog 2, period homolog 2 (Drosophila) |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PER2 (O15055). MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?