Peptidase Inhibitor 16/PI16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18403951	Novus Biologicals NBP1-92254-25ul	25 μL

Description

Peptidase Inhibitor 16/PI16 Polyclonal specifically detects Peptidase Inhibitor 16/PI16 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: Peptidase Inhibitor 16/PI16
• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CRISP9, CRISP-9, Cysteine-rich secretory protein 9, dJ90K10.5, DKFZp586B1817, MGC45378, microseminoprotein, beta-binding protein, MSMBBP, peptidase inhibitor 16, PI-16, protease inhibitor 16, PSP94-binding protein, PSPBP
• Gene Symbols: PI16
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q6UXB8
• Gene ID (Entrez): 221476
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVT
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only