PEPT1/SLC15A1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93362-0.1ml

Product Code. 18647241

Description

PEPT1/SLC15A1 Polyclonal antibody specifically detects PEPT1/SLC15A1 in Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: PEPT1/SLC15A1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: Caco-2 oligopeptide transporter, HPECT1macrophage oligopeptide transporter PEPT1, HPEPT1, Intestinal H(+)/peptide cotransporter, Oligopeptide transporter, small intestine isoform, PEPT1intestinal H+/peptide cotransporter, Peptide transporter 1, solute carrier family 15 (oligopeptide transporter), member 1, solute carrier family 15 member 1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human SLC15A1 (NP_005064.1). VTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVCVIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6564
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG