missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pepsinogen I Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | Pepsinogen I |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18263280
|
Novus Biologicals
NBP2-54730 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698227
|
Novus Biologicals
NBP2-54730-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Pepsinogen I Polyclonal specifically detects Pepsinogen I in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Pepsinogen I | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 643834 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:GTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| pepsinogen 3, group I (pepsinogen A) | |
| PGA3 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title