missing translation for 'onlineSavingsMsg'
Learn More

PELP1 Antibody (1F7), Novus Biologicals™

Product Code. 18372949 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18372949 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18372949 Supplier Novus Biologicals Supplier No. H00027043M01100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

PELP1 Monoclonal antibody specifically detects PELP1 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen PELP1
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1F7
Conjugate Unconjugated
Dilution Western Blot 1:100 to 1:2000, ELISA 1:100 to 1:2000, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAW80659.1
Gene Alias HMX3, MNARmodulator of nongenomic activity of estrogen receptor, Modulator of non-genomic activity of estrogen receptor, P160, proline and glutamic acid rich nuclear protein, proline, glutamate and leucine rich protein 1, proline, glutamic acid and leucine rich protein 1, proline-, glutamic acid- and leucine-rich protein 1, proline-, glutamic acid-, leucine-rich protein 1, Transcription factor HMX3
Host Species Mouse
Immunogen PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cellular Markers, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 27043
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.