missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PEG10 Polyclonal specifically detects PEG10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | PEG10 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | embryonal carcinoma differentiation regulated, Embryonal carcinoma differentiation-regulated protein, HB-1, KIAA1051EDR, Mammalian retrotransposon-derived protein 2, Mar2, Mart2, MEF3 like 1, MEF3L, MEF3L1, Myelin expression factor 3-like protein 1, paternally expressed 10, Paternally expressed gene 10 protein, retrotransposon gag domain containing 3, Retrotransposon gag domain-containing protein 3, Retrotransposon-derived gag-like polyprotein, retrotransposon-derived protein PEG10, RGAG3MEF3-like protein 1, Ty3/Gypsy-like protein |
| Gene Symbols | PEG10 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?