missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEDFR/PNPLA2/ATGL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£294.00 - £461.00
Specifications
| Antigen | PEDFR/PNPLA2/ATGL |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18079143
|
Novus Biologicals
NBP2-58046 |
100 μL |
£461.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18651198
|
Novus Biologicals
NBP2-58046-25ul |
25 μL |
£294.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PEDFR/PNPLA2/ATGL Polyclonal specifically detects PEDFR/PNPLA2/ATGL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PEDFR/PNPLA2/ATGL | |
| Polyclonal | |
| Rabbit | |
| Autophagy, Cancer, Diabetes Research, Lipid and Metabolism, Lipid Droplets, Signal Transduction | |
| Adipose triglyceride lipase, ATGL1110001C14Rik, Calcium-independent phospholipase A2, Desnutrin, EC 3.1.1.3, FP17548, IPLA2-zeta, patatin-like phospholipase domain containing 2, patatin-like phospholipase domain-containing protein 2, patatin-like phospholipase domain-containing protein 2-like, PEDF-R, Pigment epithelium-derived factor, Transport-secretion protein 2, transport-secretion protein 2.2, triglyceride hydrolase, TTS2.2, TTS-2.2, TTS2DKFZp667M109 | |
| PNPLA2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 57104 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title