missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pecanex Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94285-0.02ml
This item is not returnable.
View return policy
Description
Pecanex Polyclonal antibody specifically detects Pecanex in Human samples. It is validated for Western Blot
Specifications
| Pecanex | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FLJ23409, KIAA0805FLJ45663, KIAA0995pecanex-like 1, PCNXL1, Pecanex homolog, pecanex homolog (Drosophila), pecanex-like 1 (Drosophila), pecanex-like protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 2250-2341 of human Pecanex (NP_055797.2). VDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV | |
| 0.02 mL | |
| Neuroscience | |
| 22990 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction