missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDZRN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£328.00 - £513.00
Specifications
| Antigen | PDZRN3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18248894
|
Novus Biologicals
NBP2-55802 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18657228
|
Novus Biologicals
NBP2-55802-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PDZRN3 Polyclonal specifically detects PDZRN3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PDZRN3 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 23024 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| E3 ubiquitin-protein ligase PDZRN3, EC 6.3.2.-, Ligand of Numb protein X 3, likely ortholog of mouse semaF cytoplasmic domain associated protein 3, LNX3KIAA1095SEMACAP3, PDZ domain containing ring finger 3, PDZ domain-containing RING finger protein 3, Protein SEMACAP3, Semaphorin cytoplasmic domain-associated protein 3, SEMCAP3 | |
| PDZRN3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title