missing translation for 'onlineSavingsMsg'
Learn More

PDZK1 Antibody, Novus Biologicals™

Product Code. 18433701 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18433701 25 μL 25µL
18422721 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18433701 Supplier Novus Biologicals Supplier No. NBP18257225ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PDZK1 Polyclonal antibody specifically detects PDZK1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen PDZK1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias CAP70, CFTR-associated protein of 70 kDa, CLAMP, Na(+)/H(+) exchanger regulatory factor 3, Na/Pi cotransporter C-terminal-associated protein 1, naPi-Cap1, NHERF-3, NHERF3PDZD1Na(+)/H(+) exchange regulatory cofactor NHE-RF3, PDZ domain containing 1, PDZ domain-containing protein 1, PDZ-containing kidney protein 1, Sodium-hydrogen exchanger regulatory factor 3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQDGDRVLRINGVFVDKEEHMQVVDLVRKSGNSVTLLVLDGDSYEKAV
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Diabetes Research, Endothelial Cell Markers, Growth and Development, Lipid and Metabolism, Neuronal Cell Markers, Plasma Membrane Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5174
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.