missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PDLIM3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PDLIM3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PDLIM3 Polyclonal specifically detects PDLIM3 in Human samples. It is validated for Western Blot.Specifications
| PDLIM3 | |
| Polyclonal | |
| Rabbit | |
| Q53GG5 | |
| 27295 | |
| Synthetic peptides corresponding to PDLIM3(PDZ and LIM domain 3) The peptide sequence was selected from the N terminal of PDLIM3. Peptide sequence PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Actinin-associated LIM protein, ALPFLJ26096, Alpha-actinin-2-associated LIM protein, DKFZp686L0362, enigma homolog, PDZ and LIM domain 3, PDZ and LIM domain protein 3 | |
| PDLIM3 | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title