PDK4 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-95194-0.1ml

Product Code. 18688672

Description

PDK4 Polyclonal antibody specifically detects PDK4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PDK4
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial, EC 2.7.11, EC 2.7.11.2, FLJ40832, Pyruvate dehydrogenase kinase isoform 4, pyruvate dehydrogenase kinase, isoenzyme 4, pyruvate dehydrogenase kinase, isozyme 4, pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 312-411 of human PDK4 (NP_002603.1). STAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
• Quantity: 0.1 mL
• Research Discipline: Cancer, Lipid and Metabolism, Mitochondrial Markers, Protein Kinase, Signal Transduction
• Gene ID (Entrez): 5166
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified