PDIK1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56732

Product Code. 18235965

Description

PDIK1L Polyclonal specifically detects PDIK1L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PDIK1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: casein kinase, CLIK1LRP11-96L14.4, EC 2.7.11.1, PDLIM1 interacting kinase 1 like, PDLIM1-interacting kinase 1-like, serine/threonine-protein kinase PDIK1L, STK35L2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 149420
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N165
• Gene Symbols: PDIK1L
• Immunogen: Synthetic peptides corresponding to PDIK1L(PDLIM1 interacting kinase 1 like) The peptide sequence was selected from the middle region of PDIK1L. Peptide sequence FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG