missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18388198

PDE8A Antibody (1H6), Novus Biologicals™

Product Code. 18388198 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18388198 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18388198 Supplier Novus Biologicals Supplier No. H00005151M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

PDE8A Monoclonal antibody specifically detects PDE8A in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen PDE8A
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1H6
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002596
Gene Alias cAMP-specific cyclic nucleotide phosphodiesterase 8A, EC 3.1.4.17, FLJ16150, high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A, high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A, HsT19550, phosphodiesterase 8A
Host Species Mouse
Immunogen PDE8A (NP_002596.1, 32 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5151
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.