missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Beskrivelse
PDCD7 Polyclonal specifically detects PDCD7 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Tekniske data
Tekniske data
| Antigen | PDCD7 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | apoptosis-related protein ES18, ES18programmed cell death protein 7, FLJ54213, hES18, MGC22015, programmed cell death 7, U11/U12 snRNP 59K |
| Gene Symbols | PDCD7 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL |
| Vis mere |
For Research Use Only
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?