missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PDCD7 Antibody, Novus Biologicals™

PDCD7 Antibody, Novus Biologicals™

Artikelnummer. 18404632 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Quantity:
0.1 mL
25ul
Pakningsstørrelse:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18404632 25ul 25µL
18110900 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18404632 Leverandør Novus Biologicals Leverandørnr. NBP21374325ul

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

PDCD7 Polyclonal specifically detects PDCD7 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen PDCD7
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias apoptosis-related protein ES18, ES18programmed cell death protein 7, FLJ54213, hES18, MGC22015, programmed cell death 7, U11/U12 snRNP 59K
Gene Symbols PDCD7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 10081
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.