missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCYT1A Rabbit anti-Human, Clone: 1D9L4, Novus Biologicals™
Description
PCYT1A Monoclonal antibody specifically detects PCYT1A in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | PCYT1A |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 1D9L4 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | CCT A, CCT-alpha, choline-phosphate cytidylyltransferase A, CT, CT A, CTA, CTP:phosphocholine cytidylyltransferase A, CTPCTphosphate cytidylyltransferase 1, choline, alpha isoform, EC 2.7.7, EC 2.7.7.15, PCYT1CCTA, phosphate cytidylyltransferase 1, choline, alpha, Phosphorylcholine transferase A |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 268-367 of human PCYT1A (P49585). EEKSIDLIQKWEEKSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYDISEDEED |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?