missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCNA associated factor Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35127-20ul
This item is not returnable.
View return policy
Description
PCNA associated factor Polyclonal antibody specifically detects PCNA associated factor in Human samples. It is validated for ELISA,Western Blot
Specifications
| PCNA associated factor | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| HCV NS5A-transactivated protein 9, Hepatitis C virus NS5A-transactivated protein 9, KIAA0101, NS5ATP9p15PAF, OEATC-1OEATC1, Overexpressed in anaplastic thyroid carcinoma 1, p15(PAF), PAF, PCNA-associated factor | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human PCNA associated factor (NP_055551.1).,, Sequence:, SSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE | |
| 20 μL | |
| Cancer | |
| 9768 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction