missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCMTD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£222.00 - £513.00
Specifications
| Antigen | PCMTD1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18233144
|
Novus Biologicals
NBP2-55851 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18691739
|
Novus Biologicals
NBP2-55851-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PCMTD1 Polyclonal specifically detects PCMTD1 in Human, Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PCMTD1 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| FLJ10883, protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1, protein-L-isoaspartate O-methyltransferase domain-containing protein 1 | |
| PCMTD1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 115294 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts